SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000014885 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000014885
Domain Number 1 Region: 549-820
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-81
Family Eukaryotic proteases 0.0001
Further Details:      
 
Domain Number 2 Region: 333-439
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000249
Family Spermadhesin, CUB domain 0.0042
Further Details:      
 
Domain Number 3 Region: 69-161
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000458
Family SEA domain 0.0063
Further Details:      
 
Domain Number 4 Region: 518-557
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 482-513
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000563
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 6 Region: 231-317
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000864
Family Spermadhesin, CUB domain 0.0062
Further Details:      
 
Domain Number 7 Region: 447-479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000275
Family LDL receptor-like module 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000014885   Gene: ENSPVAG00000015778   Transcript: ENSPVAT00000015779
Sequence length 821
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3526:77290:108719:-1 gene:ENSPVAG00000015778 transcript:ENSPVAT00000015779 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPMAEAPQASGGQGDGGDGEEAEPEGMFKAPKNSRRKIQYYLRLAPLWLALVVLASGGFL
LWYFLGFKAEVTVSQVYSGSLRVLNRHFSQDLVHRESSAFRSETAKAQNMLKALIVSTRL
GIYFNSSSVYSFGEGSLTCFFWFILQIPEHRRPMLSPEVVQALLVEELLSTANASALAPY
RAEYEPDPEGLVILEASVKDVVALFTLGCYRYSYVGQGQVLQLKGPDYLASSCLWHLQGP
KDLMLKLRLEWTLADCRDRLAMYDAAGPLERRLITSVYGCSRQEPVVEVLASGAVMAVVW
KKGLHSYYDPFTLSVQAVAFQACEVNLTLEGQLEPQGVLSTPYFPSYYSPSTHCSWHLTV
PSLDYGLALWFDAYALRRQKYDLPCTQGQWMIQNRRLCGLRTLQPYAERIPIMATASITI
NFTSQISLTGPGVQVHYSVYNQSDPCPGEFLCSVNGLCVPTCDGVKDCPNGLDERNCVCR
ATFQCQEDSTCVSLSRICDGQPDCLNGSDEEQCQEGVPCGTFTFQCADRSCVRKPNPQCD
GQPDCPDGSDEQHCDCGLQGPSGRIVGGAMSSEGEWPWQASLQVRGRHICGGALIADRWV
ITAAHCFQEDSMASAALWTVFLGKVWQSSRWPGEVSFKVSRLFLHPYHEEDSHDYDVALL
QLDHPVVRSAAVRPVCLPTRSHLFEPGLRCWITGWGALREGALGVGIMAPFCGWGNGSET
FSSCCPTSNGLQKVDVQLIPQDLCSEAYRYQVTPRMLCAGYRKGKKDACQGDSGPLVCRE
PSGRWFLAGLVSWGLGCGRPNFFGVYTRITGVIGWIRQVLT
Download sequence
Identical sequences ENSPVAP00000014885 ENSPVAP00000014885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]