SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015122 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015122
Domain Number 1 Region: 494-719
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.96e-49
Family Eukaryotic proteases 0.00000000948
Further Details:      
 
Domain Number 2 Region: 115-209
Classification Level Classification E-value
Superfamily Kringle-like 2.05e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 210-292
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-33
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 4 Region: 380-480
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-29
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 5 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 7.06e-22
Family Hairpin loop containing domain 0.00000533
Further Details:      
 
Domain Number 6 Region: 346-385
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000701
Family Kringle modules 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015122   Gene: ENSPVAG00000016023   Transcript: ENSPVAT00000016023
Sequence length 727
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_97:33567:96002:-1 gene:ENSPVAG00000016023 transcript:ENSPVAT00000016023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQQVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLHKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDQQMP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSSMNDSNXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEDTTPTIVNLD
HPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYXXXXXXXXXXXXKSWILTARQCFHSRDL
KDYEAWLGIHDVHGRGDEKRRQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLPN
YGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAGA
ENIVTGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIIL
TYKVPQS
Download sequence
Identical sequences ENSPVAP00000015122 ENSPVAP00000015122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]