SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015208 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015208
Domain Number 1 Region: 74-317
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.44e-67
Family Eukaryotic proteases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015208   Gene: ENSPVAG00000016114   Transcript: ENSPVAT00000016114
Sequence length 348
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_268:252237:300227:1 gene:ENSPVAG00000016114 transcript:ENSPVAT00000016114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPALLSAVLLFVGSPLLYSEHYLVSEGSRRGPPWGQASGPRWPEAVRGQPRQQKEEGLE
AEDCGIAPLADGLKRPRIIGGTDAQIGAWPWIVSLQIQYGKILAHVCGGSLVRDRWVLTA
AHCTKDSRDPLMWRAVLGTNNIHGRHPPTKIIKVKAIIIHPDFDLESFVNDVALFHLKKK
VKYNEYIQPICLPFDVFQNLDQNTKCFIGGWGRTKEEXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXIFDTCRGDSGGPLMCYLPEHKQFFVMGITSYGYGCGRKNFP
GVYSGPSFYKTWLTDHLYNTRNNGIFNTNILLGQVLIALGSAVLLATP
Download sequence
Identical sequences ENSPVAP00000015208 ENSPVAP00000015208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]