SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015677 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015677
Domain Number 1 Region: 15-261
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.27e-84
Family Eukaryotic proteases 0.00000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015677   Gene: ENSPVAG00000016611   Transcript: ENSPVAT00000016611
Sequence length 264
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_150:268177:269996:-1 gene:ENSPVAG00000016611 transcript:ENSPVAT00000016611 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLSLILSLIVLGSSWGCGIPAIKPTLSFNQRIVNGDNAVPGSWPWQVSLQDSSGFHFC
GGSLISQSWVVTAAHCKVIPGRHFVVLGEYDRSSSAEPLQVLSISQAITHPDWNPTIINN
DLTLLKLTSPAQYTTRISPVCVASPDEVLSTGLTCVTTGWGRLSGLGNVTPARLQQVALP
LVTVRKCQQYWGSRVTDSMICAGGSGASSCQGDSGGPLVCQKGNVWVLIGIVSWGTTNCN
VHAPAMYTRVSKFSTWINEVTAYS
Download sequence
Identical sequences ENSPVAP00000015677 ENSPVAP00000015677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]