SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015808 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015808
Domain Number 1 Region: 311-559
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.56e-47
Family Eukaryotic proteases 0.00027
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000615
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 3 Region: 98-204
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000144
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 4 Region: 210-248
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000131
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 246-282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000013
Family LDL receptor-like module 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015808   Gene: ENSPVAG00000016754   Transcript: ENSPVAT00000016755
Sequence length 563
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3218:7702:29724:1 gene:ENSPVAG00000016754 transcript:ENSPVAT00000016755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCHFKLVATVGYLIRLSVESVQIEADNCVTDSLTIYDSLLPIRSTILYRICEPTRTLMSF
VSTSNLMLVTFKSPQIRRLSGIRAYFEVIPEQKCENTVLVKEITGFEGKISSPYYPSYYP
PKCKCTWKFQTPLSTLGIALKFHNYSITKKSVKGCDHGWWEINEHMYCGSYMDHQTIFRV
PSPLVHIQLQCSSRLSDKPLLVEYGSYNISQPCPVGSFRCSSGLCVPQAQRCDGVNDCFD
ESDELFCVTHKPACNASSFRQHGPLVCDGFRDCEDGQDEKNCTQSIPCNSRTFKCGNDIC
FRKQNAKCDGTVDCSDGSDEECCSCSRSFSTVNRIIGGTDTRGCLQVSLFSYCGSVISRW
LLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAKFVSPVRRIVIHEYYNSQTFDYDIALLQL
SVAWPETLRQLIQPICIPPAGQKVRSGEKCWVTGWGRRHEAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLSCRRESDGKWILTGIVSWGHGCGRPN
FPGVYTRVSNFVSWIHKYVPSLL
Download sequence
Identical sequences ENSPVAP00000015808 ENSPVAP00000015808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]