SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015936 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015936
Domain Number 1 Region: 213-297
Classification Level Classification E-value
Superfamily Snake toxin-like 8.8e-22
Family Extracellular domain of cell surface receptors 0.0000994
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000015936
Domain Number - Region: 23-56
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000135
Family Extracellular domain of cell surface receptors 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015936   Gene: ENSPVAG00000016896   Transcript: ENSPVAT00000016896
Sequence length 335
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1288:135956:147843:-1 gene:ENSPVAG00000016896 transcript:ENSPVAT00000016896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVPLLLPLLFLVQTCIPATWGLRCMLCERTENCQVKECDLGQDLCRTTVLHIWEXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXLELQNLPPNGLQCYSCEGNSTHGCSSEETSLTACRGP
MNQCLEATGTTEVENASYTVRGCATPSWCQSLHVAEAFRLTHLSVSCCSGNGCNHPNLDI
QPRVGGAPRTGPVHLSFTITLLMTARLWGGTLLWT
Download sequence
Identical sequences ENSPVAP00000015936 ENSPVAP00000015936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]