SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016018 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016018
Domain Number 1 Region: 38-127
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.46e-34
Family SCAN domain 0.0000938
Further Details:      
 
Domain Number 2 Region: 768-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000016018
Domain Number - Region: 840-883
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000333
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 224-281
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0759
Family KRAB domain (Kruppel-associated box) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016018   Gene: ENSPVAG00000016982   Transcript: ENSPVAT00000016981
Sequence length 916
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2371:8391:19840:-1 gene:ENSPVAG00000016982 transcript:ENSPVAT00000016981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPEMDAPLEVEGYLIMKVEKDPGWASEPALQGPGSSESETFRRCFRQFCYEDVSGPHEA
FSKLWELCCRWLKPEMRSKEQILELLVIEQFLAILPEKMQAWAQKQCPESGEEAVALVMH
LERETGRRRQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXHPLPWAPVPAEEWTTADQEVRSARLPVGSQRPVKDVHVARGFSYRK
SMRQVPAHRGLFRDGREESAEDVVSLGSAVSVSNEIARLEHRRAPWTVDPHPAHSRSGLR
SSHVKEASARAVQGPARGAGKAWREQQWGLEDEKVAGVHWSYEETKTFLAILRESRFYET
LQACPRNSQVYGAVAEWLRECGFLRTPEQCRTKFKSLQKSYRKARSGHVLEPCAFFEDMD
ALLNPAARTSSADKPKETASLPRPKRVGAGAEEQISLLEEEEAAEESGGEEMGIEFLRKA
GLRAAPVLFQNLSGVHWGYEETKTFLDILRETRFYEALQACHRKSKLYGAVAEQLRECGF
LRTPEQCRTKFKSLQKSYRKARSGPVLEPCAFYREMDALINARAPPTPGGAPCPSGRERE
GMRIEPQDPTGWEPEQLSPAATAGDSGSERLSREEAMPEPERQGPAFTVGVSVKEDATQI
EDDAEQARALTEKARRAAPQNPDPGRAHRGDGTSGRPWGALQGVRRGKPACRPRDPGRAV
AHQRPCAGRGPHRPLRCGDGSARGARLGCRATRQKENAHKCRVCGKCFGRSRSLARHQRT
HTGDKPFRCLDCGQSFNDSSNFGVHQRAHAGEKPNRCTECGQRSTGGAYGRGESSCGGAD
CEQSFSSCARFREHRRTQAGDRPHGCARCSGRLGKSLALSRHREAPGRDQLPPRPSPPCL
PEQPRRGKVDDLRKQL
Download sequence
Identical sequences ENSPVAP00000016018 ENSPVAP00000016018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]