SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016449 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016449
Domain Number 1 Region: 45-136
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-38
Family SCAN domain 0.0000781
Further Details:      
 
Domain Number 2 Region: 274-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.41e-20
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 246-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016449   Gene: ENSPVAG00000017438   Transcript: ENSPVAT00000017437
Sequence length 335
Comment pep:known_by_projection scaffold:pteVam1:scaffold_2024:100341:102938:1 gene:ENSPVAG00000017438 transcript:ENSPVAT00000017437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAKLRDSSTLLPQTSEEPDSILVVKMEEEEAGNLDSSLHWRSCYSPETFRQRFRQFGYQ
ESPGPREALNQLRKLCCQWLRPEVYTKKQILELLVLEQFLAILPEELQAWLQEHPPEDGE
EAVTMLEELEKELDGPTEQVFGQNEDMPTEKLAPWEIIQESSSTQLKPEKKQLQCSSREV
HSSRQNDKDTRTINMKSASRQKTSSGTELHYNVSNIVHMNASQGFTSRGTCEQGSRFERR
HRNPSRKKQHKCDECGKTFSQSSALILHQRIHSGEKPYACDVCAKAFSRSAVLIQHRRIH
TGEKPYKCHECGKAFSQSSNLFRHRKSHTREKIPL
Download sequence
Identical sequences ENSPVAP00000016449 ENSPVAP00000016449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]