SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016452 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016452
Domain Number 1 Region: 47-137
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.52e-39
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 249-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-18
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016452   Gene: ENSPVAG00000017441   Transcript: ENSPVAT00000017441
Sequence length 368
Comment pep:known_by_projection scaffold:pteVam1:scaffold_2024:113474:116815:1 gene:ENSPVAG00000017441 transcript:ENSPVAT00000017441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQSVEEDSILIIPTPDEEEKILRVKLEEDPDGEEGSSIPWNHLSDPEVFRQRFRQFGY
QDSPGPREAVSQLRELCRLWLRPETHTKEQILELVVLEQFVAILPKELQTWVREHHPENG
EEAVTVLEDLESELDDPGQPVSLRRRKREVLVEEIVSQEEAQGLPSSELDAVENQLKWAS
WELHSLRHCDDDARTENGALAPKQEIPSAVESHEVPGTLNIGVPQIFKYGEACFPKGRFE
RKRNPSRKKQHICDECGKHFSQGSALILHQRIHSGEKPYGCVECGKAFSRSSILVQHQRV
HTGEKPYKCLECGKAFSQNSGLINHQRIHTGEKPYECVQCGKSYSQSSNLFRHQRRHNAE
KLLNVVKV
Download sequence
Identical sequences XP_011359913.1.92234 ENSPVAP00000016452 ENSPVAP00000016452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]