SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016457 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016457
Domain Number 1 Region: 43-133
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.24e-38
Family SCAN domain 0.0000767
Further Details:      
 
Domain Number 2 Region: 336-393
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 392-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-24
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 4 Region: 434-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.44e-21
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 283-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.48e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016457   Gene: ENSPVAG00000017447   Transcript: ENSPVAT00000017447
Sequence length 493
Comment pep:known_by_projection scaffold:pteVam1:scaffold_2024:147111:153998:1 gene:ENSPVAG00000017447 transcript:ENSPVAT00000017447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGKATALAYHAAKEQEGLVKVVKAEEENYVWGQGFDLQGNACSQETYRQQFRQFGYSDS
TGPREALSRLRELCRQWLKPEMYTKEQILELLVLEQFLSILPEELQAWLQKHRPENGEEA
VTMLEELEKELDEPVQQDTTHSQGMIWMEMTSMRALKSLSMQLQPLENQCKSGTQELQAF
HERGGKLVANKVLTAKQEIIERVASTAMISPGRIPRETPSGQIVEEALGGLENIKKPKGN
ATKNKMSQPPSQKRHFSLATFNKKISTEENVLECDESEGSLSLNSNVTAQQRIHTAGKFY
ECFDCGKAFCQSSKLIRHQRIHTGERPYACKECGKAFNLSSDLVRHQRIHSGEKPYECCE
CGKAFRGSSELIRHRRIHTGEKPYECGECGKAFSRSSALIQHKKIHTGDKGYECIECGKA
FGRSSILIEHQRIHTGEKPYQCNECGKSFNQSSALTQHQRIHTGEKPYECSECRKTFRHR
SGLMQHQRTHTRV
Download sequence
Identical sequences ENSPVAP00000016457 ENSPVAP00000016457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]