SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016459 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016459
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.97e-38
Family SCAN domain 0.0000419
Further Details:      
 
Domain Number 2 Region: 375-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-27
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 319-376
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 472-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.38e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016459   Gene: ENSPVAG00000017450   Transcript: ENSPVAT00000017449
Sequence length 531
Comment pep:known_by_projection scaffold:pteVam1:scaffold_2024:159641:164121:-1 gene:ENSPVAG00000017450 transcript:ENSPVAT00000017449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVESTAISTLASRNPQEQELILVKVEESLSWGQKLKQNESTQSCQELFRQQFRKFCYQE
TPGPREALGRLQELCYQWLMPELHTKEQILELLVLEQFLSILPEELQIWVQQHSPKSGEE
AVTLLEDLEREFDDPGQQVPASPQGPAIPWKDSTCLGASQELNIQLQPLKTQLKPWEPCL
SPQSDCENSESATKKDILGEKSGLPQEPSSGGVSEHESNLEWQQGSATGEKLGRSPSQGD
SFSQIIFTHKSLGKRDHHEPQRSLILSTNSVTYQKVPTEERPYRCDVCGHSFKQHSSLTQ
HQRIHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAFNQSSALIRHRKI
HTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHTGE
RPYECNECGKFRQSSELITHQRIHSGEKPYECNECGKAFSLSSNLIRHQRIHSGEEPYQC
NECGKTFKRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLMRHQRVHTVK
Download sequence
Identical sequences ENSPVAP00000016459 ENSPVAP00000016459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]