SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016502 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016502
Domain Number 1 Region: 27-236
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.14e-45
Family Eukaryotic proteases 0.00000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016502   Gene: ENSPVAG00000017493   Transcript: ENSPVAT00000017493
Sequence length 239
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2706:130196:138541:1 gene:ENSPVAG00000017493 transcript:ENSPVAT00000017493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFSSLSLFFLIAGAYLTPECFNMEIIGGKEVSPHSRPFMASLQYGGNHVCGGVLIHPQ
WVLTAAHCHDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XLHMVAKLDKHVQLLYPSTKNSIKAGTKCHVTGWGTTDPELFRPSDTLREVTVTIIDRKL
CNSPRYYNRNPIITKDMVCAGDAKGQKDSCQGDSGGPLVCKGAFYALVSGGRKCGVAKK
Download sequence
Identical sequences ENSPVAP00000016502 ENSPVAP00000016502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]