SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016653 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016653
Domain Number 1 Region: 28-111
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.1e-27
Family SCAN domain 0.0004
Further Details:      
 
Domain Number 2 Region: 384-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 425-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-16
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 346-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016653   Gene: ENSPVAG00000017654   Transcript: ENSPVAT00000017654
Sequence length 488
Comment pep:novel scaffold:pteVam1:scaffold_16462:1391:5444:-1 gene:ENSPVAG00000017654 transcript:ENSPVAT00000017654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDQTFLWSHGKPQESVPLRFQPEGQDCNAETWHVTFRAFTGSEESDPVEDLRRLQELC
HLWLRPDVHTKDQILDKLVMEQFMISMPQELQVLVKESGVDSCKDLEDMLRSNAKPKKWT
VVSLQGQKFLLRNSDVVMAEAEVSDTDDVTDLSRKPPSSVSKTEIHPENSQKVFQKLEDV
PRIDEMSRGQGWGVLPETVPEKGELEGLRPAQNSEEDPMEDKEEMMTSPESRPLKCPEES
VRAEDGKNPQEATCIKNVDADVPCTHGSETEVLTQSWKGKDSWSPRDPQRRKQGNTSIPQ
EAPQEGAMSLDTEEFSRQLRSNSKHSPITMGPFGHSVRKEATRQTPYECGTCKKRFNYES
QLNVHQRTHTGDRPFKCMVCLKGFMQSSDLRVHQRVHTGEKPYTCKVCFKQFTHDSTLRS
HQRVHTNEKPYQCEVCDKHFNHKGNLNVHLRTHSGAKPYLCHQCHQDFRQLGTLKRHQKT
HLKVTTQR
Download sequence
Identical sequences ENSPVAP00000016653 ENSPVAP00000016653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]