SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016664 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016664
Domain Number 1 Region: 359-612
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-63
Family Eukaryotic proteases 0.00051
Further Details:      
 
Domain Number 2 Region: 223-335
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-30
Family Spermadhesin, CUB domain 0.00066
Further Details:      
 
Domain Number 3 Region: 40-152
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.33e-25
Family Eukaryotic proteases 0.0029
Further Details:      
 
Domain Number 4 Region: 653-755
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.76e-18
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 5 Region: 781-868
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000406
Family Spermadhesin, CUB domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000016664
Domain Number - Region: 182-215
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0327
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016664   Gene: ENSPVAG00000017663   Transcript: ENSPVAT00000017665
Sequence length 870
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_256:202276:244791:-1 gene:ENSPVAG00000017663 transcript:ENSPVAT00000017665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALAGAGVLLLFAVDLRTSSGLKCGVQAVDLKSMETVSESEFFTRIISWRNSTVDGHLW
QVSLKLCEHHFCRGSLIQGDLAVTAAHCLVRLNEKQIKSLTVIAGEYNLFQKDKQEQTIP
VSKIVIHPEYNRLGYMSSDIALPHLKHKVKFXXXXXXXXXXXXXXXXXXXXXXXXXFMED
NIRNKHLTETNKAKVTFVSDAENSGNGFEFTFRAVQKNSEAGSCRGSVTEFVEEGTIHSA
SYPDLYPRNVSCHWFIHAPEKHVIKLAFEDFNTEFNQNCIYDAAVIYSDPEEEHELAKLC
GIFNPTPIFSPGNMMVIHFKSDDENNFGFKARFTFLPSDFLNKIGSTSPPQNHPVSSEKT
IPYGICGIPPFSPQWLSRRIVGRGEACPYCWPQVGRFLGNYHCGGAIISPDWILTAAHCV
QLKNNPLFWSVVAGDHDRTLKESTNQVRRAKHIVMHEDFDRLSFDLYIALVQLSSLLAFS
SAVRPMCLPHSTEPLFPSEICAVTGWGSVSEDSGLANRFQQSMLEREMCEHTYYFAHSGG
ITEKMICTGFTATGGKNFCQGDSAGPLVYRHEKDPFVLYGIINWGAGCAQSRKPVGFARV
SVFLDWIQSKLKGSASLQINNESKTLTKKQLSPLTASTDNASELGCYSEVELEEPKGFFS
TPRYPLDYRGKLECSWVLRVSPRSMAKFTVEYLSLPGSRMCLDSVLTIYEESHGEIRMSD
KLCGGRLYPMIFMSSGPLVRVTFQSLVQGTFGISYIVFRVQDPKGSKITRLLQSANQGHV
TTCKGVILTKPVGTIHIPKYFHRITMSCHWRLLAPLHHIIRLDTINFQMKPTPLFCQGHQ
WVYEGFGSGKKLIFVRSVDRRKRFSSNSNY
Download sequence
Identical sequences ENSPVAP00000016664 ENSPVAP00000016664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]