SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000016880 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000016880
Domain Number 1 Region: 71-122
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.00000606
Family Viral proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000016880   Gene: ENSPVAG00000017893   Transcript: ENSPVAT00000017894
Sequence length 411
Comment pep:known_by_projection scaffold:pteVam1:scaffold_3156:98693:118909:-1 gene:ENSPVAG00000017893 transcript:ENSPVAT00000017894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRVLFPPLKALMGRPCVRLLVPRATPRTQCGCSCGIKRPWRPGQYSTISEVALQSGRGT
VSLPSKAAEQMVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEW
EAEFQKYQQFPEFKILNHDMTLAEFKFIWYMEYSHRMWGRLVGLAYILPAAYFWRKGWLS
RGMKGRVLALCGLVCFQGLLGWYMVKSGLEEKPDSHDIPRVSQYRLAAHLGSALVLYCAS
LWTSLSLLLPQHKLETRLLWLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGES
WIPEDLFTFSPTLRNVFENPTMVQFDHRLLGISSVTAVTVLYFLSQRIPLPRRTKMAAVT
LLALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLSAALWLMNELRRVPK
Download sequence
Identical sequences ENSPVAP00000016880 ENSPVAP00000016880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]