SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Pteropus vampyrus 76_1 > ENSPVAP00000000370

Domain assignment for ENSPVAP00000000370 from Pteropus vampyrus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSPVAP00000000370
Domain Number 1	Region: 220-308
Classification Level	Classification	E-value
Superfamily	DEATH domain	0.0000000000000268
Family	DEATH domain, DD	0.007
Further Details:

Domain Number 2	Region: 9-51
Classification Level	Classification	E-value
Superfamily	TRADD, N-terminal domain	0.00000000000536
Family	TRADD, N-terminal domain	0.00029
Further Details:

Domain Number 3	Region: 133-164
Classification Level	Classification	E-value
Superfamily	TRADD, N-terminal domain	0.000000157
Family	TRADD, N-terminal domain	0.00097
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSPVAP00000000370 Gene: ENSPVAG00000000401 Transcript: ENSPVAT00000000400
Sequence length	311
Comment	pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2486:219994:221830:-1 gene:ENSPVAG00000000401 transcript:ENSPVAT00000000400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAAGPNGPKEWVGSAYLFVEPSLDKVVLSDAYAHPQQKMAVYRALRTALAXXXXXXXXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXXXXXXRCLSCIFAHKPDRLRDEELAELEAALRNLTCGPGGQGGDVEVAPTPS NSLAPSLSKEKPLPPPPGQTFLFQGQPVVNRPLNLQDQQMFARSVGLKWRKVGRSLQRSC RALRDPALEALAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL LGLANPDGGLA
Download sequence
Identical sequences	ENSPVAP00000000370 ENSPVAP00000000370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]