SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000523 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000523
Domain Number 1 Region: 579-652
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.09e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 437-536
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.51e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000237
Further Details:      
 
Domain Number 3 Region: 1047-1122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.8e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000957
Further Details:      
 
Domain Number 4 Region: 646-722
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.47e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000103
Further Details:      
 
Domain Number 5 Region: 145-218
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.68e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000126
Further Details:      
 
Domain Number 6 Region: 1117-1199
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000767
Further Details:      
 
Domain Number 7 Region: 969-1045
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.91e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000104
Further Details:      
 
Domain Number 8 Region: 728-831
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.42e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 9 Region: 345-431
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000494
Further Details:      
 
Domain Number 10 Region: 866-918,945-968
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 11 Region: 290-365
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000745
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 12 Region: 218-293
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000108
Family Eukaryotic type KH-domain (KH-domain type I) 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000523
Domain Number - Region: 99-148
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0501
Family Eukaryotic type KH-domain (KH-domain type I) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000523   Gene: ENSPVAG00000000555   Transcript: ENSPVAT00000000556
Sequence length 1265
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2589:136851:166235:-1 gene:ENSPVAG00000000555 transcript:ENSPVAT00000000556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVAVLTQESFAEHRSGLVPQQIRVATLNSEEESDPPTYKDAFPPLPEKAPCSESTQEP
AGAWGNKIRPIKASVITQVFHVPLEERKYKDMNQFGEGEQAKICLEIMQRTGAHLELSLA
KDQGLSIMVSGKLDAVMKARKDIVARLQTQASATVAIPKEHHRFVIGKNGEKLQDLELKT
ATKIQIPRPDDASNQIRITGTKEGIEKARHEVLLISAEQDKRAVERLEVEKAFHPFIAGP
YNRLVTEIMQETGTRINIPPPSVNRTEIVFTGEKEQLAQAVARIKKIYEEKKKKTTTIAV
EVKKSQHKYVIGPKGNCLQEILERTGVSVEIPPSDSSSETVILRGEPEKLGQALTEVYAK
ANSFTVSSVSAPSWLHRFIIGKKGQNLARVTQQMPKVHIEFTEGEDKITLEGPTEDVNVA
REQIEAMVKDLSNRMDYVEINIDHKFHRHLIGKSGANINRVKDQYKVSVRIPPDSEKSSL
VRIEGDPQGVRQAKRELLDLASRMENERTKDLVIEQRFHRTIIGQKGERIREIRDKFPEV
IINFPDPAQKSDIVQLRGPKNEVEKCTKYMQKMVADLVENSYSISVPIFKQFHKNIIGKG
GANIKKIREESNTKIDLPAENSNSETIVITGKRANCEAARSRILSIQKDLANITEAEVSI
PAKLHNSLIGTKGRLIRAIMEECGGVHIHFPVEGSGSDTVVIRGPSSDVEKAKRQLLHLA
EEKQTRSFTADVRAKPEYHKFLIGKGGGKIRKVRDTTGARIIFPTAEDKDQDLITIMGKE
DAVREAQKELEALIQNLDNVVEDCMLVDPKHHRHFVIRRGQVLREIAEEYGGVMVSFPRS
GTQSDKVTLKGAKDCVEAAKKRIQEIIEDLEAQVTMECAIPQKFHRSVMGPKGSRIQQIT
RDYNVQIKFPDREENPVHSMEPAVQENGDDTGESREAEPGSPRRCDIIVISGRKEKCEAA
KEALEALVPVTVEVEVPFDLHRYIIGQKGSGIRKMMDEFEVNIHVPAPELQSDIVAITGL
AANLGRAKAGLLERVRELQAEQEDRALRSFKLSVTVDPKYHPKIIGRKGAVITQIRLEHD
VSIQFPDKDDGSQPQDQITITGYEKNTEAARDAILKIVGELEQMVSEDVSLDHRVHARII
GARGKAIRKIMDEFKVDIRFPQSGAPDPNCVTVTGLPENVEEAIDHILNLEEEYLADVVD
SEVLQVYMKPPAHEEARAPSKGFVVRDAPWTASNSEKAPDMSSSEEFPSFGAQVAPKTLP
WGPKR
Download sequence
Identical sequences ENSPVAP00000000523 ENSPVAP00000000523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]