SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000797 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000797
Domain Number 1 Region: 762-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000156
Family Laminin-type module 0.0000576
Further Details:      
 
Domain Number 2 Region: 658-709
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000921
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 3 Region: 220-278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family Laminin-type module 0.038
Further Details:      
 
Domain Number 4 Region: 818-866
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.0002
Further Details:      
 
Domain Number 5 Region: 869-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000502
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 6 Region: 381-431
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 7 Region: 332-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 8 Region: 276-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000276
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 707-764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.00023
Further Details:      
 
Domain Number 10 Region: 917-962
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000212
Family Laminin-type module 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000797
Domain Number - Region: 1214-1460
Classification Level Classification E-value
Superfamily Tropomyosin 0.00124
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number - Region: 34-109
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00616
Family Galactose-binding domain 0.034
Further Details:      
 
Domain Number - Region: 621-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0307
Family EGF-type module 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000797   Gene: ENSPVAG00000000844   Transcript: ENSPVAT00000000844
Sequence length 1543
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1634:128344:228521:1 gene:ENSPVAG00000000844 transcript:ENSPVAT00000000844 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTCGTPPEEYCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAG
VQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGRWAPYQYYSGSCENTY
LKANRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTA
TDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFGKLVCN
CKHNTYGVDCEKCLPFFNDRPWRRATAESARECLPCDCNGRSQECYFDPELYRSTGHGGH
CTNCQDNTDGASCERCRENFFRLGNKEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGDK
CDHCQPGFHSLTEAGCRPCSCNPSGSIDECNIETGRCVCKDNVEGFNCERCKPGFFNLEP
SNPRGCTPCFCFGHSSVCTNAVGYSVYPITSTFQTDEDGWRAEQRDGSEASLEWSSERQD
VAVISDSYFPRYFIAPAKFLGKQVWSYGQNLSFSFRVDRRDTRLSAEDLLLEGAGLRVAV
PLIAQGNSYPSETTVKYVFRLHEATDYPWRPTLTPFEFQKLLTNLTSIKIRGTYSERSAG
YLDDVTLASARPGPGVPATWVEACTCPAGYGGQFCETCLSGYRRETPSLGPYSPCVPCAC
NGHSETCDPETGVCNCRDNTAGPQCERCSDGYYGDSSLGTSSDCQPCPCPGGSSCAVVPK
TQEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNCNRLT
GECLKCIYNTAGFYCDRCKNGFFGNPLAPNPADKCKACNCNPYGTTQQQSNCNPVTGQCE
CLPHVTGRDCGSCDPGFYNLQGGQGCERCDCHALGSTNGQCDIRSGQCECQPGITGQHCE
RCEVNHFGFGPEGCKPCDCHPEGSVSLQCKDDGRCECREGFVGNRCDRCEENYFYNRSWP
GCQECPACYRLVKDKVAEHRVKLQELENLVANLGTGEEVVTDQAFEDRLKEAEREVMDLL
REAQDVKDVDHNLMDRLQRVNNTLSSQISRLQNIRNTIEETDNLAEQARARVESTEQLIE
IASRELEKAKIAVANVSVAQPESTRDPNNMTLLAEEARRLAERXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXNQTAFEIEELNRKYEQAKNISQDLEKQAAQVHEEAKRAGDKAVE
IYASVAQLTPVDSEALENEANKIKKEAEDLEHLIDQKLKDYEDLREDMRGKELEVKNLLE
KGKTEQQTADQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEE
ALKRIPAINRTIAEANEKTAEARLALGNAAADATEAQAKAHEAERIASAVQKNATSTKAE
AERTFAEVTDLDNEVNNMLRQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKA
KNSVTSLLSLINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEAK
KQEAAIMDYNRDIEEIMKDIRNLEDIRKTLPSGCFNTPSIEKP
Download sequence
Identical sequences ENSPVAP00000000797 ENSPVAP00000000797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]