SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001055 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001055
Domain Number 1 Region: 651-895
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-65
Family Nuclear receptor ligand-binding domain 0.000000000241
Further Details:      
 
Domain Number 2 Region: 537-614
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.16e-25
Family Nuclear receptor 0.0000166
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000001055
Domain Number - Region: 365-394
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00254
Family Formin homology 2 domain (FH2 domain) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001055   Gene: ENSPVAG00000001117   Transcript: ENSPVAT00000001117
Sequence length 897
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2926:27456:170348:1 gene:ENSPVAG00000001117 transcript:ENSPVAT00000001117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVQLGLGRLYPRPPSKTYRGAFQNLFQSVCEVIQTPGPRHPEPASAAPPGARLQQQQQQ
QQQQQRRRESSSGRQPQQGDDGSPQSQGRCPAGYLALEQEPQPAQHQPAPEGRADSGCIP
EPGAAAAAGKGLPPPPPAPPDEDDSAAPSTLSLLGPTFPGLSGCPANLKDILSEAGSMQL
LQQPPQPPQQEATSEGGSGGRAREAAGAPTSSKDSYLAGNSSISDSAKELCKAVSVSMGL
GVESLEHLGPGEQLRGDCMYAPLLGGPPAVRPTACTQLAECKGSLLDERPSKGAEDTSDY
PPFKTGYAKALDGDSLGRSGGGEAEVSGPLELPSSLSLYKSGALEEASAYQSRDYYNFPL
ALAGPPPPPPPPPHPHARIKLENPLDYSSAWAAAAAAAQCRYGDLASLHGGGAAGPGSGS
PSAAAASSWHTLFTAEDGQMYGPCGSGAGASAGEGGLCVPLYGLPRPPHGLAGESDFPPP
DVWYPGGVVSRVPYPTPSCVKSEMGPWMEGYSGPYGDMRLETARDHVLPIDYYFPPQKTC
LICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKC
YEAGMTLGARKLKKLGNLLHEGESSSTRPTEEPSQKLAVSHIEGYECQPIFLNVLEAIEP
GVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWM
GLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQ
EFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKL
LDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ
Download sequence
Identical sequences ENSPVAP00000001055 ENSPVAP00000001055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]