SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001187 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001187
Domain Number 1 Region: 260-543
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.69e-19
Family WD40-repeat 0.0065
Further Details:      
 
Domain Number 2 Region: 450-532,722-831,882-918
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000000000604
Family WD40-repeat 0.02
Further Details:      
 
Domain Number 3 Region: 973-1088
Classification Level Classification E-value
Superfamily EF-hand 0.00000001
Family Calmodulin-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001187   Gene: ENSPVAG00000001265   Transcript: ENSPVAT00000001265
Sequence length 1145
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3673:134957:187784:1 gene:ENSPVAG00000001265 transcript:ENSPVAT00000001265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDAEENPLEAEEDGETETEEEEYDTNYYKEVENMQQESKDDTVAWGDSQEEERRKGEEG
EEEEEEEEEETVSASELEEDSGTAQEEVAAGIQEETTAELQGATKSTISVERHITDYQSA
MSETFSQTYSASESKHSLQSEHPRSLGSQLEFLGLDLTSSEEQETDSAERWLSDEPGEKT
SQMPQDEPEQDRGGLEPEGEKKKEKAVSYFQPKAIVSEDSLVSTTTEDMLFQKNDSDSVY
PLTLSWSFGWNSSLPVYYIRDKNQRVLLYASTHTAVIYNVLRNSQRHLQGHLNVISCLCV
SEDRRWIATADKGPNSLIIIWDSFTGIPVHTIFDSCPDGSGIRAIAMTFDAKYLATISDA
EIQKVCIWRWTLAVETPACSLDLPKEYGFQSYLTFNPTNNKELVSNSKTQAIYYSWNERG
NVLTHSAPVLTEKTFNKLVGKFSQSIFHLNLTQVLSATMEGKLVVWDIHRPPPAASASLG
PPYIKPCKLVHLQKESITVLTAVDSYIVTGDIKGSIKFYDHTLAIVNWYSHFKLGSIRTL
SFSRTPASPPTEKSNYPPDCTLKGDPFVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDASFTVAVYKVRVRNG
QRVWEYLARLRSHRQSIRSLLFGVHLDSNEPRLLSLGKDRLLIEYNLLKSCRDHLEVLDI
HQTDQGNYPTCMIWYPPLTKELFMLVCNSGYKVKLFNSTTKMCRKTLLGPVYGSPIEQIQ
ILPVKTAMELQKRYLVFINRDKVGLQILPVDGNPHKTSAIICHPDGVAGMALSCDGRYAF
TAGGQDRSVIQWEINLSALEAAVSLGGEGLTPFYSLVSGGREGKFYRELEDYFYYSQLRG
QGIDTMETRKVSEHICLSELPFVMRAIGFYPSEEKIEDMFNEIRFSEYVDSGEIVDKINL
PDFLKVYLNHRPPFGNTMYAIERSFNILGYTNSKGKKVIRREDFLKLLLTKGEHMTEEEL
SDCLATLLGLNPEGWKSEPAAASTKGSQLCLEDELPDEITAEIFATEILGLALSSSSRRE
PTDHQ
Download sequence
Identical sequences ENSPVAP00000001187 ENSPVAP00000001187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]