SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001600 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001600
Domain Number 1 Region: 583-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000435
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 620-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000139
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.00000863
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000803
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001600   Gene: ENSPVAG00000001695   Transcript: ENSPVAT00000001695
Sequence length 718
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2059:283580:291534:1 gene:ENSPVAG00000001695 transcript:ENSPVAT00000001695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAAATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLAIPTFAPQVR
MVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTIATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSGAGRAY
LHQEHAARPGAAGAADGLCLSPKPPVPDFAAATPAGTLRPHLQALPPVQASGARESIKRE
ASSTPSATSPPPAKWGPSKKGKEQPDRTLDMSGSARGHGHFLGIVGGSPTGGGGLAFYPG
VRSAFKPASLARAAAAAHGDPYREEGGGKPGTGLVLGRLLGGGRPGGRPGSRENPAAGGA
GHHHHHHGHHHHHPKCLLTGDPPPPPPPGLPCSGALRGFPLLSSPPEEVSAFKHVERAPP
AVATLPGARYTQLPGVTGLPLERCALPALDAGGLKAYPGGECSHLPAVMPAFTVYNGELL
YGSPAAAAYYPLKLHFGGLLKYPESISYFSGPAAAALSPAELGSLASIDREIAMHTQQLS
EMAAGKGRGRLDAGTLPPAIVPSGGAGGGGSGGGGAGRPKTGHLCLYCGKLYSRKYGLKI
HMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVK
SRHPGQNLLAKTSDGPGAEPDYPPEPGEPKSDNDSDVDVCFTDDQSDLEAGCGGERDS
Download sequence
Identical sequences ENSPVAP00000001600 ENSPVAP00000001600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]