SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001775 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001775
Domain Number 1 Region: 7-34,74-141
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.63e-22
Family Voltage-gated potassium channels 0.0045
Further Details:      
 
Domain Number 2 Region: 136-200
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000487
Family Voltage-gated potassium channels 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001775   Gene: ENSPVAG00000001879   Transcript: ENSPVAT00000001879
Sequence length 394
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1746:292231:329025:1 gene:ENSPVAG00000001879 transcript:ENSPVAT00000001879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQNVRTLALIVCTFTYLLVGAAVFDALESEPEMIERQRLELRQQELRARYNLSQGGYE
ELERVVLRLKPHKAGVQWRFAGSFYFAITVITTIGYGHAAPSTDGGKVFCMFYALLSIPL
TLVMYQSLGERINTFVMYLLHRAKRGLGMRRADVSMANMVLIGFFSCISTLCIGAAAFSY
YEHWTFFQAYYYCFISLTTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCVEQSHSSPGGGGRYSDTPSHR
CLCSGAQRSAISSVSTGLHSLSAFRGLMKRRSSV
Download sequence
Identical sequences ENSPVAP00000001775 ENSPVAP00000001775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]