SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002608 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002608
Domain Number 1 Region: 175-439
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.31e-86
Family Nuclear receptor ligand-binding domain 0.000000000175
Further Details:      
 
Domain Number 2 Region: 71-152
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.25e-24
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002608   Gene: ENSPVAG00000002761   Transcript: ENSPVAT00000002761
Sequence length 440
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_940:14660:26676:1 gene:ENSPVAG00000002761 transcript:ENSPVAT00000002761 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPPEEAPEVREEEEKEEVAETQGAPELNGGPEHSLPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRMTIRMKLEYEKCERSCKIQKN
RNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTASEGSQHNPQVADLKAFSKH
IYNAYLKNFNMTKKKARGILTGKTSHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKEI
SVHVFYRCQCTTVETVRELTEFAKSIPSFGNLFLNDQVTLLKYGVHEAIFAMLASIVNKD
GLLVANGTGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDR
PGLMNVSQVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIK
KTETETSLHPLLQEIYKDMY
Download sequence
Identical sequences ENSPVAP00000002608 ENSPVAP00000002608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]