SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002671 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002671
Domain Number 1 Region: 223-456
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.29e-38
Family Voltage-gated potassium channels 0.0011
Further Details:      
 
Domain Number 2 Region: 63-177
Classification Level Classification E-value
Superfamily POZ domain 3.92e-28
Family Tetramerization domain of potassium channels 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002671   Gene: ENSPVAG00000002828   Transcript: ENSPVAT00000002828
Sequence length 505
Comment pep:known_by_projection scaffold:pteVam1:scaffold_7943:5501:10146:-1 gene:ENSPVAG00000002828 transcript:ENSPVAT00000002828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLLPGDNSDYDYSALSCTSDASFHRAFLPQSQSLKGVFYRRAQRLRPQDEPRPGGPPED
RRRRIIINVGGIKYSLPWTTLEEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRN
PGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKMEEFAEMV
EREDEDDPLDSEDHDSEGPSEAEGRLGRCMRRLRDMVERPHSGLPGKVFACLSVLFVTVT
AVNLSISTLPSLREEEEQQCSMCHDVFIVESVCVGSLERLRLIQAPSKFALRSPLLIDLV
ILPYYIQLVDGAASGRRKTGTGNSYLDKVGLVLRVLRALRILYVMRLARHSLGLQTLGLT
ARRCTREFGLLLLFLCVAIALFAPLLYVIENEMADSPEFTSIPACYWWAVITMTTVGYGD
MVPRSTPGQVVALSSILSGILLMAFPVTSIFHTFSRSYLELKQEQERVMFRRAQFLIKTK
SQLSGMSQDSDILFGSASSDTRDKN
Download sequence
Identical sequences ENSPVAP00000002671 ENSPVAP00000002671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]