SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002972 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002972
Domain Number 1 Region: 33-483
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.49e-95
Family Integrin alpha N-terminal domain 0.000000000000512
Further Details:      
 
Domain Number 2 Region: 772-996
Classification Level Classification E-value
Superfamily Integrin domains 6.02e-57
Family Integrin domains 0.00046
Further Details:      
 
Domain Number 3 Region: 633-766
Classification Level Classification E-value
Superfamily Integrin domains 4.03e-35
Family Integrin domains 0.00011
Further Details:      
 
Domain Number 4 Region: 483-632
Classification Level Classification E-value
Superfamily Integrin domains 1.1e-34
Family Integrin domains 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002972   Gene: ENSPVAG00000003144   Transcript: ENSPVAT00000003150
Sequence length 1020
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_20:101423:114441:-1 gene:ENSPVAG00000003144 transcript:ENSPVAT00000003150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALCPLHALWLLEWMQLLLGPGAAPPAWALNLDPVRLSSYTGPNGSYFGFSLDFFKDS
HSSMAIVVGAPRTLGRSQEETGGVFLCPWRAEGGQCTSLPFDLNDETREVGSQTFQTFKA
QQGLGASVVSWRDNIVACAPWQHWNALENNAEAEKTSVGGCFVAQLQDGGRAEYSPCRAN
TMSRVYAENKFWEDKRYCEAGFSSVITQNGELVLGAPGGYFFLGLLVRAPIADIVSSYRP
GTLLWHVRTQRFTSDTSNPEYFDGYRGYSVAVGEFDGDLGTTEYVFGAPTWRWTLGAVEI
LRSNFRTLYRLHGEQVASYFGHSVAVTDVNGDGRHDLLVGAPLYMERRADRKLAEVGRVY
LFLQPRGPHGLGTPSLLLTGTQLYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPSGRGQV
LVFLGQSEGLSSYPSQVLDSPFPEGSGFGFSLRGAADIDDNGYPDLLVGAYGADKVAVYR
AQPVVMATVQLLVQDSLNPAVKNCIMTKTPVSCFNIQMCIGVTGHNIPQKLRLNVELQLD
RQKPRQGRRVLLLSSQQASATLNLDLGGRHSPICHNTTAFLRDEADFRDKLSPIVLSVNV
SLQPEDGLAPALVLHGDTHVQEQTRIILDCGEDDLCVPQLHLTASVKGSPLLIGADNVLE
LQMEAANNGEGAYEAELAVYLPPGAHYMRALSNVEGFERLICNQKKENETKVVLCELGNP
MKRNVRIGITMLVSVESLEEAGENVSFWLQIRSKNSQNPNSETVLLNVPVRAEAHVELRG
NSFPAFLVVAAEEGDRENNLDDWGPKMEHTYELHNNGPGTVSGLRLSLHLPGQSQSSDLL
YILDIQTQGGLQCSPQPSPNPHKLDWGLPTPTPSPIYPAHHKRERRQAFLPGPKESSRLQ
NPVLVSCDSAPCTVVQCELQEMVRGQRAMVTMLAFLQLPSLRQRPLDQFVLQSQAWFNVS
SLPYAVPALSLPTGEALVQTQLLRALEERDIPIWWVLVGVLGGLLLLTLLVLAMWKGGFF
Download sequence
Identical sequences ENSPVAP00000002972 ENSPVAP00000002972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]