SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003219 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003219
Domain Number 1 Region: 55-162
Classification Level Classification E-value
Superfamily SRCR-like 6.41e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 466-569
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 3 Region: 337-441
Classification Level Classification E-value
Superfamily SRCR-like 9.29e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000916
Further Details:      
 
Domain Number 4 Region: 244-285
Classification Level Classification E-value
Superfamily SRCR-like 0.000000405
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003219   Gene: ENSPVAG00000003405   Transcript: ENSPVAT00000003405
Sequence length 570
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1373:256826:265549:-1 gene:ENSPVAG00000003405 transcript:ENSPVAT00000003405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEAEMQIGPQPDEESREWRPGDRSTAPAPLSPALSFLLLLPLAGALQSTPLPFPELRL
VGGPSRCRGRLEVLHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRKVLTSKALPTTP
QNGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXGTGHILLDNVHCEGGEPRTCLGWGVHNCGHHEDAGVLCAVLAPLTLTALPPSAT
REDWWPTEPEATRVGALPARETTLFSTASWAAGKKSGRLRLVGGPGPCRGRVEVMYAGGW
GTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTETRLSDCFH
LGWGQHNCGHHEDAGALCSGPEELGLQVQHDGSETTRVPXXXXXXXHLRLANGAHRCEGR
VELFLGQRWGTVCDDAWDLRAASVLCHQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGD
ESTLLLCSHIRWDAHNCDHSEDASVLCRPL
Download sequence
Identical sequences ENSPVAP00000003219 ENSPVAP00000003219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]