SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003589 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003589
Domain Number 1 Region: 30-72
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000112
Family Somatomedin B domain 0.0053
Further Details:      
 
Domain Number 2 Region: 69-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000275
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003589   Gene: ENSPVAG00000003793   Transcript: ENSPVAT00000003793
Sequence length 258
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3403:251086:270029:-1 gene:ENSPVAG00000003793 transcript:ENSPVAT00000003793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALCALARLWPGALAGCAEAGRCCPGRDPACFARGWRLDRVYGTCFCDQACLLTGDCCFD
YARACPARPCIVGSWSPWSGCADQCKPTARVRRRPVQQEPRNGGAPCPALEERAGCLQYS
TPQGRACGHAFVPAFITTSAFNKERTRQAASPQWSTRTQDAGYCMEFKTESLTHHCAMEN
RPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPCQGTWKK
VRRVDQCTCPAVHSFIFI
Download sequence
Identical sequences ENSPVAP00000003589 ENSPVAP00000003589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]