SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000003861 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000003861
Domain Number 1 Region: 232-258,300-505
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.8e-60
Family Voltage-gated potassium channels 0.00073
Further Details:      
 
Domain Number 2 Region: 104-201
Classification Level Classification E-value
Superfamily POZ domain 4.97e-26
Family Tetramerization domain of potassium channels 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000003861   Gene: ENSPVAG00000004081   Transcript: ENSPVAT00000004081
Sequence length 597
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1416:25145:27248:1 gene:ENSPVAG00000004081 transcript:ENSPVAT00000004081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIALVSLENGGAMTVKGGGEARAGCGQATGGELQCPPTVALRDGPKEPAPRGRSVQRSA
DPGRRPLPSLPSRQLPPVDEEGEGDPTLGMEEDQAPSAGALHHQRIFINISGLRFETQLG
TLAQFPNTLLGDPAKRLRYFDPLRNEYFFDRNRPSFDGILYYYQSGGRLRRPVNVSLDVF
ADEIRFYQLGDEAMARFREDEGFIKEEEKPLPRNEFQRQVWLIFEYPESSGSARAIAIVS
VLVILISIITFCLETLPEFRDERELLRHPPVPHQPAGPARGANGSRARVPPSGPTVAPLL
PRTLADPFFIVETTCVIWFTFELLVRFFACPSKAEFSRNIMNIIDVVAIFPYFITLGTEL
AEPQPGGGGGGGQNGQQAMSLAILRVIRLVRVFRIFKLSRHSKGLQILGKTLQASMRELG
LLIFFLFIGVILFSSAVYFAEADNQETHFSSIPDAFWWAVVTMTTVGYGDMRPVTVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYLYHRETDHEEQAPKEXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXAEGARRGSCPLEKCNLMAKSNVDLRRSLYALCLDASRETDL
Download sequence
Identical sequences ENSPVAP00000003861 ENSPVAP00000003861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]