SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004202 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004202
Domain Number 1 Region: 302-330,362-563
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-59
Family Voltage-gated potassium channels 0.00058
Further Details:      
 
Domain Number 2 Region: 175-271
Classification Level Classification E-value
Superfamily POZ domain 8.63e-27
Family Tetramerization domain of potassium channels 0.00000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004202   Gene: ENSPVAG00000004439   Transcript: ENSPVAT00000004437
Sequence length 652
Comment pep:known_by_projection scaffold:pteVam1:scaffold_4728:63088:65046:-1 gene:ENSPVAG00000004439 transcript:ENSPVAT00000004437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQSRGSCTSHDPQSSRGSRRRRRQRPEKKKVHHRPSSFPHCSDLMPSGSEEKILRE
LSEDEGEEEEDEEEEEGRFYYSEDDHGDECSYTDLLPQDDGGGGYSSVRYSDCCERVVIN
VSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGGRL
KRPVNVPFDIFTEEVKFYQLGEEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEYPE
SSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLIMALSAGGHSGLLNNTSAPHPEN
SGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITLGT
DLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELGLL
IFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKIVG
SLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRSST
SSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNVKAVETDV
Download sequence
Identical sequences L5KX80
ENSPVAP00000004202 ENSPVAP00000004202 XP_006908055.1.64745 XP_011360861.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]