SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004418 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004418
Domain Number 1 Region: 179-408
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.5e-57
Family Voltage-gated potassium channels 0.00075
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 1.12e-31
Family Tetramerization domain of potassium channels 0.000000986
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004418   Gene: ENSPVAG00000004666   Transcript: ENSPVAT00000004666
Sequence length 655
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_255:33969:175482:-1 gene:ENSPVAG00000004666 transcript:ENSPVAT00000004666 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVAAWLPFARAAAIGWMPVANCPMPLAPADKNKRQDELIVLNVSGRRFQTWRTTLER
YPDTLLGSTEKEFFFNEDTKEYFFDRDPEVFRCVLNFYRTGKLHYPRYECISAYDDELAF
YGILPEIIGDCCYEEYKDRKRENAERLMDDNDSENNQESMPSLSFRQTMWRAFENPHTST
LALVFYYVTGFFIAVSVITNVVETVPCGTVPGSKELPCGERYSVAFFCLDTACVMIFTVE
YLLRLFAAPSRYRFIRSVMSIIDVVAIMPYYIGLVMTNNEDVSGAFVTLRVFRVFRIFKF
SRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPASFWY
TIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRR
AQKKARLARIRVAKTGSSNAYLHSKRNGLLNEALELMGTPEEGHMGKATSLIESQHHHLL
HCLEKTTGLSYLVDDPLLSVRTSTIKNHEFVDEQMFEQNCMESSMQNYPSTRSPSLSSHP
GLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDG
LRPNCKASQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Download sequence
Identical sequences XP_006919704.1.64745 XP_011365499.1.92234 XP_011365507.1.92234 ENSPVAP00000004418 ENSPVAP00000004418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]