SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004574 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004574
Domain Number 1 Region: 181-504
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.83e-83
Family Integrin alpha N-terminal domain 0.0000000000142
Further Details:      
 
Domain Number 2 Region: 801-1028
Classification Level Classification E-value
Superfamily Integrin domains 2.41e-68
Family Integrin domains 0.0000000032
Further Details:      
 
Domain Number 3 Region: 505-664
Classification Level Classification E-value
Superfamily Integrin domains 3.5e-35
Family Integrin domains 0.000000291
Further Details:      
 
Domain Number 4 Region: 665-793
Classification Level Classification E-value
Superfamily Integrin domains 6.8e-27
Family Integrin domains 0.000000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004574   Gene: ENSPVAG00000004831   Transcript: ENSPVAT00000004832
Sequence length 1048
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_265:240037:314092:1 gene:ENSPVAG00000004831 transcript:ENSPVAT00000004832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRELRGLQCCCPRPASPAPHAQPSRLPRSCPALARTPAAGESRRAQAAGHGHRALGWWP
RLRARRPARASAMASPPPRWLRLRPRRLLLLLAGFLLPLCGAFNLDVDSPAEYSGPEGSY
FGFAVDFFVPSASSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNR
DYAKDDPLEFKSHQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVE
YAPCRSSQLISDQVAEIVSKYDPKVYSIKYNNQLATRTAQAVFDDSYLGYSVAVGDFNGD
GIDDFVSGVPRAARTLGMVYIYDGKNMSSLYNFTGEQMAAYYGFSVAATDINGDDYADVF
IGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTRLNGFEVFARFGSAIAPLGDLDQDG
FNDIAIAAPYGGEDKKGIVYIFNGRSTGLNAVPSQILEGKWAAQSMPPSFGYSMKGATDI
DKNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVYPSILNQDSKTCPLPGTDLKVSXXX
XXXXXXXXXXXXXXXXXXFQVELLWDKLKQKGAIRRALFLHNRSPSHSKNMTISRGGQMQ
CEEVIAYLRDESEFRDKLTPITIFMEYRLDYRRAADATGLQPILNQFTPANVSRQAHILL
DCGDDNVCKPKLEVSVDRDQKKIYIGDDNPLTLIVKAQNQGEGAYEAELIVSIPPQADFI
GVVRNSEALARLSCAFTENIRVLCLGNMKAGTKLLAGLRFSVHQQSEMDTSVKFDLQIQS
SNLFDKVSPVVSYRVDLAVLTAVEIRGVSSPDHIFLPIPNWEHKENPETEEDVGPVIQHI
YELRNNGPSSFSKAMLNLQWPYKYNNNTLLYILQYDIDGPMNCTSDMEINPLRIKVSNSQ
ATEKNDTGFGQGDRNHLITKRDLTQSEGDIHTLGCGIAECLKIVCQVGRLDRGKSAILYV
KSLLWTETFMNKENQNHSYSLKSSASFNVIEFPYKNLPIEDIFNSTLVTTNVTWGIQPAP
MPVPVWVIILAVLAGLLLLAVLVFVMYR
Download sequence
Identical sequences ENSPVAP00000004574 ENSPVAP00000004574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]