SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004687 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004687
Domain Number 1 Region: 391-646
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-65
Family Nuclear receptor ligand-binding domain 0.000000000902
Further Details:      
 
Domain Number 2 Region: 319-396
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.89e-28
Family Nuclear receptor 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004687   Gene: ENSPVAG00000004955   Transcript: ENSPVAT00000004954
Sequence length 651
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3956:177530:197030:1 gene:ENSPVAG00000004955 transcript:ENSPVAT00000004954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSVQYKIKIPNDDLHHGQRPAPAPPWCPSFCQAPKAQRMVVLSKVCPPIQSEMPCIQAQ
YGTPAPSPGPRDHLANDPLTSELSKPIMDLASSEAAPTAPTALPSFSTFMDGYTGEFDTF
LYQLPGTAQPCSSTSSSASSTSSSSATSPASASFKFEDFQVYGCYPGTLSGPLDETLSSS
GSDYYGSPCSAPSPPTPGLQPPQLSPWDGSFSPFSPNQTYEGLRAWTEQIPKAPGHPQPP
AFFSFSPPTGPSPSLAQSPLKLFPSQATHQLGDGESYAMPTAFPGLLPTSPHLDGPGMLD
VPVTSAKSQSGAPGGSEGRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKNAKYICLANK
DCPVDKRRRNRCQFCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSKPKQPPDASPANLLTS
LVRAHLDSGPSTAKLDYSKFQELVLPHFGKEDAGDVQQFYDLLSGSLEVIRKWAEKIPGF
AELSPGDQDLLLESAFLELFILRLAYRSKPAEGKLIFCSGLVLHRLQCARGFGDWIDSIL
AFSRSLHSLVVDVPAFACLSALVLITDRHGLQEPQRVEELQNRIASCLKDHVSALAGEPQ
PASCLSRLLGKLPELRTLCTQGLQRIFYLKLEDLVPPPPIVDKIFMETLPF
Download sequence
Identical sequences ENSPVAP00000004687 ENSPVAP00000004687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]