SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005243 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005243
Domain Number 1 Region: 106-356
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.21e-66
Family Nuclear receptor ligand-binding domain 0.00000000487
Further Details:      
 
Domain Number 2 Region: 9-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.83e-27
Family Nuclear receptor 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005243   Gene: ENSPVAG00000005540   Transcript: ENSPVAT00000005540
Sequence length 357
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2464:150401:154639:-1 gene:ENSPVAG00000005540 transcript:ENSPVAT00000005540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGGEDELRNCVVCGDRATGYHFHALTCEGCKGFFRRTAVKSSGLACRFAGSCKISKAQR
RHCPACRLQKCLDAGMKKDMILSAEALALRRAKQAQRRAQQAPPGLSKEQKELVQTLLEA
HARHVSTMFGQFVCFRPLPHLFIHHQQLPASLPMLPLLMHYADVNTFMVQQVIKFTKDLP
FFRSLLIEDQISLLKGAAVEICHIALNTTFCLRTRNFFCGPLRYTEEDGALVSPTVGFQK
EFLELIFRFHGTLRRLQLQEPEYVLMAAMALFSPAPRPADRPGVTQRDKIDQLQEEVALT
LHSHLRSQQPRPRDRFLYAKLLGLLAELRSLNDAYGQQIQHIQELSAMMPLLQEICS
Download sequence
Identical sequences ENSPVAP00000005243 ENSPVAP00000005243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]