SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005278 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005278
Domain Number 1 Region: 663-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-19
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 448-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-18
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.9e-16
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 4 Region: 625-677
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 709-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000429
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 546-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000132
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 379-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000963
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 69-115
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000157
Family KRAB domain (Kruppel-associated box) 0.0037
Further Details:      
 
Domain Number 9 Region: 323-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000235
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 10 Region: 271-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000277
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005278   Gene: ENSPVAG00000005577   Transcript: ENSPVAT00000005577
Sequence length 769
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1911:1555:11559:1 gene:ENSPVAG00000005577 transcript:ENSPVAT00000005577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGRRQSRGKHVFLILLLGILRAHQHGEESSPRRKDDFLPAPWSFPQPCQPGTWRRRRGSL
NEDSELSAVTEQFVTLKDFTMDFTLEDWEQLGLDQGDVFWDTALDNYQNLFLLNPPGSDL
PSPPDVAEEPEALVRGSPEATGPDIAEAKNCSPLQDFLEEGLSQELLEAFSKDGLWNFNL
GEACMDESWLDSLLGDPESLLSSDVTNVESPTKCKSHELKSGLSPEPRLPTGEESVIHDL
PEKNLTPAESQECRNDLGYHSDQSQQDTALGGEEAYKCSECGESFSRGCHLIQHWIVHMR
EKSAAKQEQESALDRSSCLFVYPTTHKSYVCNKCGKTFSQNTHLLWHQKIHTGEKPRKSQ
DRGHPSGHGSQPVEQQKTHTGAKPYKCNECGEHFSRTFRLTQHQKTHTRKRYECAKCKAT
FNFNKYLLQHQKIHAPKATSQCQERGKVFQQNLALIKHQSVHTREEPFKCDKCGKLFSHI
LTLKTHQRVHGREKTFKCTECGKAFYRNTHLNEHLRIHTGYRPHKCHKCIKSFSRPSHLI
RHQSVHATEKPYSCAECKATFRHNERLIQHQKIHAVETRYECQECGERFICSSTLTCHQS
VHTREKQGLDKSGEALNQNSEEKEKCFKCNKCEKTFSCSKDLTQHERIHTREKPFECNQC
GKAFGQSTQLDRHQMAHSGVRPYKCGDCGKAFIRSAFFAKHQRTHLSERPFKCHECGKTF
SQSARLSKHQSVHTAEKLYRCNQCDEVFAHNDHFTQHQRTHAKETSFEC
Download sequence
Identical sequences ENSPVAP00000005278 ENSPVAP00000005278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]