SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005392 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005392
Domain Number 1 Region: 21-102
Classification Level Classification E-value
Superfamily Snake toxin-like 0.000000000189
Family Snake venom toxins 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005392   Gene: ENSPVAG00000005704   Transcript: ENSPVAT00000005703
Sequence length 131
Comment pep:known_by_projection scaffold:pteVam1:scaffold_17154:14522:15206:1 gene:ENSPVAG00000005704 transcript:ENSPVAT00000005703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVFLPVLLAALLGVEQARSLVCFACTNQNSNFYCLKPTVCSDSDKYCVTVSAAAGIGNV
VDLGYSLNKGCSPVCPAPPNVNLGVASMGTHCCQSFLCNISAADGGLRASATMLGLGLLL
SLLTAVLRLGP
Download sequence
Identical sequences ENSPVAP00000005392 ENSPVAP00000005392 XP_011373230.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]