SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005865 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005865
Domain Number 1 Region: 41-130
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 6.87e-35
Family SCAN domain 0.0000471
Further Details:      
 
Domain Number 2 Region: 443-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 3 Region: 359-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000327
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005865   Gene: ENSPVAG00000006201   Transcript: ENSPVAT00000006201
Sequence length 499
Comment pep:novel scaffold:pteVam1:scaffold_15299:20111:25637:1 gene:ENSPVAG00000006201 transcript:ENSPVAT00000006201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQSRPSAALGAASAEDRAGILSVKVEDEEAGSSRSPARGPERCRLRFRGFRYPEAGGP
REALRRLRQLCRLWLRPETHSKEQIVELLVLEQFLAVLPAELRARVRGRCPESGEEAVVL
LEGPQRQLDEPRPQVPGGDQGQRLCSKMAVLTPARRSRSPQFQPVKALLERESVGPQPSA
DGALQVSGLALGGCHTGDTGVAARLTPESQGQLQMQAXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGHSSDLIKHQRTHTGK
PYECEDCGKASQSCSLLEHHRIHTGEKPYQCNTCGKAFRRNSHLRHRRVHGDKDVQDPER
GGTWENPGRVERSEGSVEALVSYTCDECERSFTRSRSLIEHQKIHTGEKPYQCDACGKGF
ARTSYLVQHQRSHGGKKSR
Download sequence
Identical sequences ENSPVAP00000005865 ENSPVAP00000005865

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]