SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005976 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005976
Domain Number 1 Region: 350-489
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-41
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 2 Region: 931-1082
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-39
Family C-type lectin domain 0.00035
Further Details:      
 
Domain Number 3 Region: 644-778
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-38
Family C-type lectin domain 0.000000211
Further Details:      
 
Domain Number 4 Region: 788-924
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-36
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 5 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.46e-34
Family Cysteine rich domain 0.000000878
Further Details:      
 
Domain Number 6 Region: 1219-1357
Classification Level Classification E-value
Superfamily C-type lectin-like 6.01e-34
Family C-type lectin domain 0.00025
Further Details:      
 
Domain Number 7 Region: 498-637
Classification Level Classification E-value
Superfamily C-type lectin-like 8.1e-32
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 230-345
Classification Level Classification E-value
Superfamily C-type lectin-like 1.32e-31
Family C-type lectin domain 0.00069
Further Details:      
 
Domain Number 9 Region: 1089-1216
Classification Level Classification E-value
Superfamily C-type lectin-like 2.36e-28
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 4.85e-20
Family Fibronectin type II module 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005976   Gene: ENSPVAG00000006324   Transcript: ENSPVAT00000006326
Sequence length 1454
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1192:4519:80471:1 gene:ENSPVAG00000006324 transcript:ENSPVAT00000006326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPPLLIFLSLIAVAAQLLDTRQFLIYNEDHKRCVEALSPSAVQTAVCNPDNEAQKFRW
VSESQIMSVSFKLCLGVPSKTDWVAITLYACDPKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNVMLFKGSGLWSRWKIYGTTDDLCSRGYEALYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSESLWKKDPLTSISYQINSKSALTW
HQARRSCQQQNADLLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSSGSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENVECVQRLGYICKKGNTTLNSFVIPSESDVPT
NCPSQWWPYTGNCYKIHREKKIQRDALMACRKEGGDLASIHTIEEFDFIISQLGYEPNDE
LWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCTVMKGKDGYWADRACEQP
LNYICKMKSQAQGSEIVEVESGCQKGWKRYGFYCYMIGHTLSTFTEANQTCVNEKAYLTT
IEDRYEQAFLTSWVGLRPERYFWTGLSDVQNRGTFQWTIEEEVQFTHWNSGMPGRKAGCV
AMRTGVAGGLWDVLRCEEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGSSTKTSLCFK
LFTKGKHEKKTWFESRDFCRALGGDLASINNKEDQQAIWRLIAVSGSYHELFWLGLTYGS
PSEGFTWSDGSPVSYENWAYGEPNNYGNTEYCGELKGDSSMSWNDINCEHLKNWICQIRK
GQKLKPEPTPAPEDNPPVTEDGWVIYKDYQYYFSKEKETMDNARGFCKRNFGDLVSIQSE
SEKKFLWKYVNKNDAQPAYLIGLLVSLDKKFIWMDGNKVDYVAWAPGEPNFANEDENCVV
MYSNSGFWNDINCGYPNTFICQRHNSSINATVIPTMTPAPGGCKEGWNFYNNKCFKIFGF
VEEERKAWQEARKACIDLGGNLASVSSEREQAFLTYHMKDSTFNAWIGLNDVNSEHTFLW
TDGRGVHFTNWGKGYPGGRRSSLSYEDADCVVIIGGTSKEAGKWMDDTCNSKRGYVCQTR
PDSSLPNPPATIPTDGFVQYGKSSYSLMKLKLQWPEAENYCKLHSSLIASILDPYSNAFA
WMQMQTFNEPVWIGLNSNATNSDYVWTDKWRVRYTNWAANEPKLKSACVYLDIDGYWKTA
YCNDSFHVLCKRSDEIPATEPPQLPGRCPETDHTAWIPFHGHCYYVESSYTRNWGQAALE
CLRMDSTLVSIESAAESSFLSYRVEPLQGKTNFWIGLYRNVEGKWLWINNNPISFVNWNT
GEPSGERNDCVTLIASSGFWSNIHCSSYKGYICKRSKIIDAEPTPTVMTTKADSRKMEPT
KQSSSVAGVVIIVILLIVMGAGLAAYLFYKKRRGHVPQENAFENTLYFNSRASPGTGDTK
DLMGNIEQNEHAVI
Download sequence
Identical sequences ENSPVAP00000005976 ENSPVAP00000005976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]