SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006632 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006632
Domain Number 1 Region: 902-1178
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.72e-87
Family Complement components 0.0000235
Further Details:      
 
Domain Number 2 Region: 1259-1387
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.45e-32
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 737-789
Classification Level Classification E-value
Superfamily E set domains 0.00000000049
Family SVA-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006632   Gene: ENSPVAG00000007027   Transcript: ENSPVAT00000007027
Sequence length 1425
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2401:16572:118194:1 gene:ENSPVAG00000007027 transcript:ENSPVAT00000007027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPRLLTAAHLVCMWTAALAATPGPRFLVTAPEIIRPGGNVTIGVQLLEHSPSQVTVKA
EVIKLAGNLTVSVQAVFENSFKTLTLPSLPLNSANEIYELHITGHAQDEILFSNSTRLSF
ETKRMTVFIQTDKTLYKPKQEVKFRVITLFANFKPYKTSLNILIKDPKSNLIQQWLTEQN
NLGVVSKTFQLSSHPMLGEWSIQVQVNDQTYHHLFQVSEYVLPKFEVALQTPLYCSLKSK
NLNGTITAKYTYGKPVKGDVTLTFLPLSFWGVKKNITKKFKINGSANFSFNDEEMKKVMD
FSDRLSEHMSLSSPGPVEILATVTESLTGISRNASANVFFKQHDYIIDLFDYATALKPSL
NFTASVKVTRSDGNQLTLEERRNNVVITVIQRNSTEYESRWKSGNQEIESVQIINCTVPQ
NGICKIEFPILDDSSMLQLKASFLNSVNSVAVHDVFKSPSKTYIQLKTKDGNIKVGSPFE
LVVSGNKQLKELSYMVVSRGQLVAVGKQSSTTFSLTPENSWAPKACIIVYYIEDDGEIIN
DVLKIPVQLVFKNKINLFWSKASAAPSEKVSLRISVTQPDSIVGIAAVDKSVNLMNASND
ITMENVVQELELYNTGYYLGMFLNSFAVFQECGLWVLTDANLVKDYIDGVYESVAFVEDA
LEENEGYLVDFYDFSVSNPRIRKNFPETWIWLDTNMGSRIYQEFEVTVPDSITSWVATAF
VISEDLGFGLTTAPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKEATEVKVIIE
KSDKFEILMASNEINATGHQQTILVPSEDGATVLFPVKPTHLGEIPITVTAISPAASDAI
TQRILVKAEGIEKLYSQSILLDLTDNKLQTTLKTLSFSFPPNTVSGSERVQITAIGDILG
SSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKKQLTENLKEKALAFMRQGYQREL
LYQREDGSFSAFGNHDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRTYTWLKGHQKSNG
EFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLKYKNYQPNIDVQESINFLESEFNRGISD
NYTLALITYALSFVGSPKAKEALNMLTRRAEQEAWQPSSLDIEVAAYALLSHFLQYKISE
GIPIMRWLSKQRNSQGGFGSTQDTVVALKALSEFAALMNTERTNIQVAVTGPSSPSPVKF
LIDTENRFLLQTAELTVLEPTEVNISANGFGFAICQLNVIYNVKDSGSSRRRRAIQNQEA
FDLDVDVKENEDDINHLNLNVCTRFLGPARSGMALMEVNLLSGFTVPLEAIPLSETVKKV
EQDHGKLNLYLDSVNGTQFCVNIPAVRNFKVSNAQDASVSIVDYYEPRRQAVRSYNSKAK
LSSCDLCGDVHGCGHCNNGASISLPHSSVIFIFCFMLLFSVQHWP
Download sequence
Identical sequences ENSPVAP00000006632 ENSPVAP00000006632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]