SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007003 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007003
Domain Number 1 Region: 151-399
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.21e-69
Family Nuclear receptor ligand-binding domain 0.00000000136
Further Details:      
 
Domain Number 2 Region: 82-165
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.94e-30
Family Nuclear receptor 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007003   Gene: ENSPVAG00000007420   Transcript: ENSPVAT00000007421
Sequence length 499
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3766:72453:96313:1 gene:ENSPVAG00000007420 transcript:ENSPVAT00000007421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMADYSAALDPAYTTLEFENVQVLTMGNVSWLVCLPRSMHPPPRHHRESTSEGGRCGST
LQGDTSPSEGANLNTTNNLGVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYS
CRFSRQCVVDKDKRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINAL
LQAEVLSQQITSPVSGINGDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDD
QVALLRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSMRILDELVLP
FQELQIDDNEYACLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFG
ELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSSSDATHAHHPLHPHLMQ
EHMGTNVIVANTMPAHLSNGQMCEWPRPRGQAATPETPQPSPPGGSGSEPYKLLPGAIAT
IVKPPSAIPQLTITKQEVI
Download sequence
Identical sequences ENSPVAP00000007003 ENSPVAP00000007003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]