SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007040 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007040
Domain Number 1 Region: 189-457
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.25e-66
Family Nuclear receptor ligand-binding domain 0.000000058
Further Details:      
 
Domain Number 2 Region: 136-217
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-30
Family Nuclear receptor 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007040   Gene: ENSPVAG00000007457   Transcript: ENSPVAT00000007459
Sequence length 463
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1931:18202:49830:-1 gene:ENSPVAG00000007457 transcript:ENSPVAT00000007459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYGNYPHFVKFPTGFGGSPSHPGATSVSPSAGLSTGKPADTHSSYTDTPVSAPRTLSTVG
TPLNALGSPYRVITSALGPPSGALAAPPGVNLVAPPSSQLNVVNGVSISEDIKPLPGLPG
VGSMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLVYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVTGMKREAVQEERQRSRERAEDEAECAAGGRGDMPVGRIL
EAELAVEPKTESYSDVNVESSMNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQVT
Download sequence
Identical sequences ENSPVAP00000007040 ENSPVAP00000007040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]