SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007121 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007121
Domain Number 1 Region: 56-185,220-333
Classification Level Classification E-value
Superfamily L domain-like 1.8e-29
Family Ngr ectodomain-like 0.021
Further Details:      
 
Domain Number 2 Region: 576-661
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-16
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007121   Gene: ENSPVAG00000007543   Transcript: ENSPVAT00000007544
Sequence length 737
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_510:119518:129623:-1 gene:ENSPVAG00000007543 transcript:ENSPVAT00000007544 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWWALLLLPPMALRTSRAGLLQERVPLFRITQQGPWGSEASNTTGTSCEGLFAAENTTLT
LVNRSLERLPDCLPRTLRSLDGSHNLLRALSARELGHLPQLQVLTLRHNRIAALRWGPGG
PAGLHTLDLSYNQLTSLPLCAGTSLGSHALELAGDPLQTLPPKAFTCFPALRLLXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTGWIKDLPKLSSLHLRKMPRL
RSLEGDIFKMTPDLQQLDCQDSPALTSVQTNIFRDTPRLQLLLLQNCNLSSFPPWTLHSS
QVLSINLFGNPLTCSCELSWLLMDAKRTVLSRAADTVCAPARSHGAFSAPLQLXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVLDPNVSAVSTPWASKH
PSLVPASPNPVSTPKPAWRTRATPQALHPSPSEGGIPILLLDDSSEEEEEGKKEKVGAPP
EDVPCDYHPCKHLQTPCAELQRRLRCRCPGLSHDDTIPDPPKLQGVSETTDTSALVRWCA
PNSVVRSYQIQYSLEGWPGNQSVVRDIYATARQHPLYGLSPGTTYRVCVLAANRAGLSQP
QASGPWGPCAAFTTKPSFVLVFAGLCAASGLLLVSTLLLSACLCRRGRATRRQHYDTHLV
AYKNPAFDNSLKLQTFS
Download sequence
Identical sequences ENSPVAP00000007121 ENSPVAP00000007121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]