SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007223 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007223
Domain Number 1 Region: 182-413
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.63e-58
Family Voltage-gated potassium channels 0.0008
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily POZ domain 6.06e-32
Family Tetramerization domain of potassium channels 0.0000053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007223   Gene: ENSPVAG00000007650   Transcript: ENSPVAT00000007650
Sequence length 646
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_676:114808:120143:-1 gene:ENSPVAG00000007650 transcript:ENSPVAT00000007650 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGVATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDR
YPDTLLGSSEKEFFYDADLGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAF
YGLVPELVGDCCLEEYRDRKKENAERLAEDEEAEKAGDGPALPAGSSLRQRLWRAFENPH
TSTAALVFYYVTGFFIAVSVIANVVETIPCRGPARRPSREQPCGDRFPLAFFCMDTACVL
IFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLFVPKNEDVSGAFVTLRVFRVF
RIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTNKTNFTSIP
AAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALYVRNRSAFEQQHHH
LLHCLEKTTCHEFTDELTFSETLGAVSLGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRR
AIRLANSTASVSHGSMQELDTLAGLRRSPAPQSRSSLNAKPHDSLDLNCDSRDFVAAIIS
IPTPPANTPDESQPSSPGGGGSGGASSTLRNSSLGTLPETVKISSL
Download sequence
Identical sequences L5JVG5
ENSPVAP00000007223 ENSPVAP00000007223 XP_006922802.1.64745 XP_011384509.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]