SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007729 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007729
Domain Number 1 Region: 1009-1102
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-25
Family PDZ domain 0.00033
Further Details:      
 
Domain Number 2 Region: 832-935
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-25
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 394-500
Classification Level Classification E-value
Superfamily PDZ domain-like 6.7e-23
Family PDZ domain 0.0000513
Further Details:      
 
Domain Number 4 Region: 697-807
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-22
Family PDZ domain 0.00043
Further Details:      
 
Domain Number 5 Region: 123-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.48e-16
Family Nucleotide and nucleoside kinases 0.0038
Further Details:      
 
Domain Number 6 Region: 289-326
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000771
Family WW domain 0.0011
Further Details:      
 
Domain Number 7 Region: 337-371
Classification Level Classification E-value
Superfamily WW domain 0.00000000089
Family WW domain 0.0029
Further Details:      
 
Domain Number 8 Region: 611-657
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000184
Family PDZ domain 0.0048
Further Details:      
 
Domain Number 9 Region: 16-111
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000499
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007729   Gene: ENSPVAG00000008174   Transcript: ENSPVAT00000008180
Sequence length 1454
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3853:209695:386538:1 gene:ENSPVAG00000008174 transcript:ENSPVAT00000008180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKTLKKKKHWLSKVQECAVSWAGPPGDVGAEIRGGAERGEFPYLGRLREEPGGGTCCIV
SGKAPSPGDVLLEVNGTPVSGLTNRDTLAVIRHFREPIRLKTVKPGKVINKDLRHYLSLQ
FQKGSVDHKLQQVIRDNLYLRTIPCTTRAPRDGEVPGVDYNFISVEQFKALEESGALLES
GTYDGNFYGTPKPPAEPSPFQPDPVDQVLFDNEFDTESQRKRTTSVSKMERMDSSLPEEE
DDEDKEAINGTGSAENRERPSESSDWMKTIPSYNQTNSSMDFRNYMMRDENLEPLPPNWE
MAYTDTGMVYFIDHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIKDPQYGTYYVDH
LNQKTQFENPVEEAKRKKQLGQADTGSSKPDMEKSHFTRDPSQLKGVLVRASLKKSAMGF
GFTIIGGDRPDEFLQVKHVLKDGPAAQDGKIAPGDVIVDINSSCVLGHTHADVVQMFQLV
PVNQYVNLTLCRGYPLPDDSEDPAVDILAVTPVINGQPLSKGEAGMNTDFKSGAAILDQN
GKPGHMLVSDRLSGPSDPSEQRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSQWCPGLQKGDIIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLILRGXXXXXX
XXXXXKTDKKENSGSLEAINEPIPQPMPFPPSVIRSGSPKLDPSEVYLKSKTLYEDKPPN
TKDLDVFLRKQESGFGFRVLGGDGPDQSIYIGAIIPLGAAEKDGRLRAADELMCIDGIPV
KGKSHKQVLDLMTAARNGHVLLTVRRKIFHGEKQPEDDSPQAFLSAQNGSPRLSRAEVPA
RPAPQEAYDVVLQRKESEGFGFVILTSKNKPPPGVIPHKIGRVIEGSPADRCGKLKVGDQ
ISAVNGQSIVGLSHDSIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMG
QSQANHIPGDRSALEGEIGKDISASYRHSWSDHKHLAQPDTATISIVGSRHSQGLGCCAV
ELERGPRGFGFSLRGGKEYSMGLFILRLAEDGPALKDGRVHVGDQIVEINGEPTQGITHT
RAIELIQAGGNKVLLLLRPGTGLIPDHGDWDITNPPSSNVIYDEQSPFPPPSPSASIFEE
SPMPATEGPLLRVQICEKAEDSRDIVPEKKSTLNENQSLLQKTVSKRDPRSSLGHSDKKN
LLRAEHGVTQRGRSASPKKSASRYSEEHLEKISSPLKNDPKRRPRDRSLSPRKGETKSCQ
SYPREGSGHDHGRKSRGRSSSPKQQQKPEGNKDQPNAEAKALAAESRRAGGRARDNAEQT
SDGKEKPAVTRKDTERSPPGNRRTRSPEKKSKRIDEKPLSKKTNYPTSRVVSENERGKKA
TLGETSSSKEKTENVRTSEKKVKQEPEQRTTVSNRTEDHKGREPEAKKTITPGPWKVPGA
RKAAGTAAVAEKRL
Download sequence
Identical sequences ENSPVAP00000007729 ENSPVAP00000007729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]