SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008075 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008075
Domain Number 1 Region: 129-309
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.27e-40
Family Nuclear receptor ligand-binding domain 0.0000000203
Further Details:      
 
Domain Number 2 Region: 34-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-27
Family Nuclear receptor 0.00000882
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008075   Gene: ENSPVAG00000008549   Transcript: ENSPVAT00000008549
Sequence length 425
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2543:680997:690415:1 gene:ENSPVAG00000008549 transcript:ENSPVAT00000008549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARSPDGKRKRKNGQCSLKTSMSGYIPSYLDKDEQCVVCGDKATGYHYRCITCEGCKGFFR
RTIQKNLHPTYSCKYDSCCVIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLI
EQNRERRRKEEMIRSLQQRPEPTPEEWDLIHVATEAHRSTNAQGSHWKQRRKFLLPCEDQ
IILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKREQLKNGGLGVVSDAIFELGKSLS
AFNLDDTEVALLQAVLLMSTDRSGLLCVDKIEKSQEAYLLAFEHYVNHRKHNIPHFWPKL
LMKEREVQSSILYKGAAAEGRPGGSLGVHPEGQQLLGMHVVQGPQVRQLEQQLGEAGSLR
GPVLQHQSPKSPQQRLLELLHRSGILHARAVCGEDDSSEAGSLSSSDEEPEVCEEDAAGH
AASPR
Download sequence
Identical sequences ENSPVAP00000008075 ENSPVAP00000008075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]