SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008131 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008131
Domain Number 1 Region: 152-186,215-441
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.64e-77
Family Nuclear receptor ligand-binding domain 0.00000000172
Further Details:      
 
Domain Number 2 Region: 102-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.38e-25
Family Nuclear receptor 0.0000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008131   Gene: ENSPVAG00000008613   Transcript: ENSPVAT00000008612
Sequence length 442
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3722:14613:173519:-1 gene:ENSPVAG00000008613 transcript:ENSPVAT00000008612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNKDRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPP
LYPSAPILGGSGPVRKLYDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVA
SCEACKAFFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRLDRV
RGGRQKYKRRIDAENSPYLNPQLVQPAKKPLLWSDPADNKIVSHLLVAEPEKIYAMPDPT
VPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSLLQSAWMEILILGVVYR
SLSFEDELVYADDYIMDEDQSKLAGLLDLNNAILQLVKKYKSMKLEKEEFVTLKAIALAN
SDSMHIEDVEAVQKLQDVLHEALQDYEAGQHVEDPRRAGKMLMTLPLLRQTSTKAVQHFY
SIKLEGKVPMHKLFLEMLEAKV
Download sequence
Identical sequences ENSPVAP00000008131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]