SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008254 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008254
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 6.54e-60
Family Dystroglycan, domain 2 0.000000371
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 1.19e-18
Family Dystroglycan, N-terminal domain 0.015
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 2.98e-18
Family Dystroglycan, N-terminal domain 0.00000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008254   Gene: ENSPVAG00000008746   Transcript: ENSPVAT00000008745
Sequence length 895
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1015:505636:518997:1 gene:ENSPVAG00000008746 transcript:ENSPVAT00000008745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMSMGLSLLLPLWGRTFLLLLSVAVTQSHWPREPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPTDLIASNGEVIKVSAVGKEALPSWLHWDSQSHTLEGL
PLDTDKGVHYIAVSAARLGANGSHVPQTSSVFSIEVYPEDHSELQSLRAASPDPGEVLSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLHRMQSFSEVELHSMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWRLGCSLSQNSVPDIRGVEAPAKEGTMSAQLGYPVVGWHIA
NKKPSLPKRVRRQIHATPTPVTALGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTMTIPGYVEPTAVATPP
TTTTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDKEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDRAPARFKAKFVGEPAPVVNDIHKKITLVKKLAFAFGDRNCSTVTLQNITQGSIVVEWT
NNTLSLAPCPKEQIMGLSRRIAEDDGKPRAAFSNALEPDFKALSIAVTGSGSCRHLQFIP
VAPPRRVPSEAPPTEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSPVAP00000008254 ENSPVAP00000008254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]