SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000008838 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000008838
Domain Number 1 Region: 139-166,198-390
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.59e-60
Family Nuclear receptor ligand-binding domain 0.0000000092
Further Details:      
 
Domain Number 2 Region: 86-170
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.75e-33
Family Nuclear receptor 0.0000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000008838   Gene: ENSPVAG00000009374   Transcript: ENSPVAT00000009374
Sequence length 426
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3521:354429:369670:-1 gene:ENSPVAG00000009374 transcript:ENSPVAT00000009374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGLLDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLXXFVSPRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLR
GISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQTGPHPKASSEDEVPGGQGK
GPQPPT
Download sequence
Identical sequences ENSPVAP00000008838 ENSPVAP00000008838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]