SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009203 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009203
Domain Number 1 Region: 215-456
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.79e-49
Family Voltage-gated potassium channels 0.0014
Further Details:      
 
Domain Number 2 Region: 61-167
Classification Level Classification E-value
Superfamily POZ domain 7.06e-27
Family Tetramerization domain of potassium channels 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009203   Gene: ENSPVAG00000009765   Transcript: ENSPVAT00000009765
Sequence length 506
Comment pep:known_by_projection scaffold:pteVam1:scaffold_14085:7759:18944:1 gene:ENSPVAG00000009765 transcript:ENSPVAT00000009765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMPSRVRGLHPRHYHFGSCSPLSHLLPGSVEPPSIKGLYYRRARKVDALDASPAADLKK
EILVNVGGRRYVLPWSTLDEFPLSRLSKLKFCRNHEEIAQLCDDYDEDNQEFFFDRSPSA
FGMIVSFLAAGKLALLREMCVLSFQEELTYWGIEEANLERCCWRKLMTKLEELAELRREE
ALLQRREACGPAVDTSRCGLFMNWLRETVENPQSGLPGKVFACLSILFVATTAVSLCVST
MPDMRAEEDKGECSQKCYYIFIVETVCVAWFSLEFCLRFVQARNKCQFFQGPLNIIDILA
ISPYYVSLAVSEEPQEDSERQGSSSYLEKVGLALRVLRALRILYVMRLARHSLGLQTLGL
TVRRCTREFGLLLLFLCVAITLFSPLVYVAENESGRVLEFTSIPASYWWAVISMTTVGYG
DMVPRSVPGQVVALSSILSGILIMAFPATSIFHTFSHSYLELKKEQEQLQTRLRRLQNST
TASERELLKDVDDLILEGPTSPIKYI
Download sequence
Identical sequences ENSPVAP00000009203 ENSPVAP00000009203 XP_011383695.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]