SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009278 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009278
Domain Number 1 Region: 240-503
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-82
Family Nuclear receptor ligand-binding domain 0.00000000021
Further Details:      
 
Domain Number 2 Region: 136-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000764
Family Nuclear receptor 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009278   Gene: ENSPVAG00000009845   Transcript: ENSPVAT00000009843
Sequence length 505
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1495:6290:69228:1 gene:ENSPVAG00000009845 transcript:ENSPVAT00000009843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGETLGDSLIDPESDSFADTLSASTSQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHAF
DIKPFTTVDFSSISTPHYEDIPFARADPMVADYKYDLKLQEYQNAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVII
LSGDRPGLVNVKPIEDIQNYLLQGLELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMCLHPLLQEIYKDLY
Download sequence
Identical sequences ENSPVAP00000009278 ENSPVAP00000009278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]