SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009730 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009730
Domain Number 1 Region: 232-327
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000228
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Domain Number 2 Region: 121-185
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009730   Gene: ENSPVAG00000010322   Transcript: ENSPVAT00000010322
Sequence length 607
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3881:76623:89847:-1 gene:ENSPVAG00000010322 transcript:ENSPVAT00000010322 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAGSATHLGAGGRRSKWDQPAPAPLLFLPPAAPGGEVPSSGGSPGGSTAAPSGALDAAA
AVAAKINAMLMAKGKLKPAQNAAEKLQAPGKGLTSSKSKDDLVVAEVEINDVPLTCRNLL
TRGQTQDEISRLSGAAVSTRGRFMTAEEKAKVGPGDRPLYLHVQGQTRELVDRAVNRIKE
IITNGVVKAATGTSPTFNGATVTVYHQPAPIVQLSPAVGQKPPFQSGMHYVQDKLFVGLE
HAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGRGSGCIEPASGREAFEPMYIYISHP
KPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPGYTQPSAISSVPPQPPCYPSSGY
QSGYPVVPPPQQPVQPPYGVPSMVPPAVSLAPGVLPALPTGVPPVPTQYPITQVQPPAST
AQSSMSGPFIPAAPVKPALPAGPPPPPPLPAQPQPQAQKRRFTEELPDERESGLLGYQHG
PIHMTNLGTGFSSQNEVEGAGSKPASSSGKERERDRQLMPPPAFPGAWIKTESDESGLAG
SHYPVKKMKTTEKGFGLVAYAADSSDEEEDHGGHKNASSFPQGWSLGYQYPSSQPRAKQQ
MPFWMAP
Download sequence
Identical sequences ENSPVAP00000009730 ENSPVAP00000009730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]